PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000245462
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 282aa    MW: 32393.1 Da    PI: 7.4725
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000245462genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.6e-141663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd++lv +++++G  +W+  ++  g+ R++k+c++rw +yl
    MDP0000245462 16 KGPWSPEEDQKLVAYIQRYGIWNWSQMPKPAGLARSGKSCRLRWVNYL 63
                     79******************99************************97 PP

2Myb_DNA-binding53.65.2e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E+e ++++++  G++ W++Ia++++ gRt++++k++w++++
    MDP0000245462  69 RGNFSXDEEETILELHQAIGNR-WSAIAARLP-GRTDNEIKNHWNTHM 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.1811163IPR017930Myb domain
SuperFamilySSF466892.31E-3014110IPR009057Homeodomain-like
SMARTSM007174.4E-101565IPR001005SANT/Myb domain
PfamPF002499.1E-131663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-231770IPR009057Homeodomain-like
CDDcd001672.63E-81863No hitNo description
PROSITE profilePS5129423.75164118IPR017930Myb domain
SMARTSM007171.3E-1568116IPR001005SANT/Myb domain
PfamPF002491.8E-1569113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-2671117IPR009057Homeodomain-like
CDDcd001677.94E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MAKRTRGCEK TVAVKKGPWS PEEDQKLVAY IQRYGIWNWS QMPKPAGLAR SGKSCRLRWV  60
NYLRPDIKRG NFSXDEEETI LELHQAIGNR WSAIAARLPG RTDNEIKNHW NTHMKKRFEX  120
AIESVHEEAK GFGDKEASKN KLSETEQLFL VDEATRASSS KMETTSSTSA SSRLFCPXWE  180
FXDXKGQIAE QSICASGVTF GDLQSLDSPV WQQEPIFPCD SYINHATSDY WYCHCHPSSP  240
PCFEGRHFEE RARQSQAKYP ITPFTVEVPI FQFIFQSQTI YT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30161197109B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.159910.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744690.0DQ074469.1 Malus x domestica MYB21 mRNA, complete cds.
GenBankKC6912480.0KC691248.1 Malus x domestica MYB transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008345862.11e-168PREDICTED: myb-related protein Myb4-like
RefseqXP_008345864.11e-168PREDICTED: myb-related protein Myb4-like
TrEMBLQ2LME31e-143Q2LME3_MALDO; MYB transcription factor
STRINGPOPTR_0013s14560.17e-57(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G05100.15e-56myb domain protein 74